Iright
BRAND / VENDOR: Proteintech

Proteintech, 17806-1-AP, FBXO42 Polyclonal antibody

CATALOG NUMBER: 17806-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FBXO42 (17806-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO42 in WB, ELISA applications with reactivity to human samples 17806-1-AP targets FBXO42 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, Jurkat cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information FBXO42 is an F-box protein that serves as a substrate recognition component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex. It plays a critical role in regulating protein degradation, cell cycle progression, and cellular processes such as chromosome alignment and spindle assembly during mitosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12084 Product name: Recombinant human FBXO42 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-343 aa of BC063864 Sequence: MASSSDSEDDSFMAVDQEETVLEGTMDQDEEPHPVLEAEETRHNRSMSELPEEVLEYILSFLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRFSHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLVVYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVIDDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDATILILGGCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHP Predict reactive species Full Name: F-box protein 42 Calculated Molecular Weight: 7171 aa, 78 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC063864 Gene Symbol: FBXO42 Gene ID (NCBI): 54455 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P3S6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924