Proteintech, 17807-1-AP, SERP1 Polyclonal antibody

Size: 20ul / 150ul The SERP1 (17807-1-AP) by Proteintech is a Polyclonal antibody targeting SERP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 17807-1-AP targets SERP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HeLa cells, mouse pancreas tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Stress-associated endoplasmic reticulum (ER) protein 1 (SERP1), also known as ribosome- associated membrane protein 4 (RAMP4), is a Sec61-associated polypeptide that is induced by ER stress [PMID:16705175]. SERP1 interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. It controls glycosylation of major histocompatibility complex class II-associated invariant chains by a translocational pausing mechanism, and its overexpression stabilizes newly synthesized membrane proteins under ER stress by associating with the Sec61 complex [PMID:10601334]. It is suggested SERP1 is involved in the biosynthesis/processing of secretory proteins Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12087 Product name: Recombinant human SERP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-66 aa of BC108314 Sequence: MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM Predict reactive species Full Name: stress-associated endoplasmic reticulum protein 1 Calculated Molecular Weight: 66 aa, 7 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC108314 Gene Symbol: SERP1 Gene ID (NCBI): 27230 RRID: AB_10597394 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6X1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.