Proteintech, 17817-1-AP, RAB27A Polyclonal antibody

Size: 20ul / 150ul The RAB27A (17817-1-AP) by Proteintech is a Polyclonal antibody targeting RAB27A in WB, IHC, IP, ELISA applications with reactivity to human samples 17817-1-AP targets RAB27A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, human liver tissue, HeLa cells, L02 cells, K-562 cells, K562, Jurkat cells Positive IP detected in: K-562 cells Positive IHC detected in: human malignant melanoma tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Rab27A is a member of a large family of Ras-related small GTPases. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Recent studies suggest that Rab27A is associated with melanosomes in pigmented cells and regulates melanosome transport via its interaction with actin-based cellular motors such as myosin Va and myosin VIIa. RAB27A is also required for regulated secretion in cytotoxic T lymphocytes. Rab27A is implicated in several diseases, including Griscelli syndrome, choroideremia, and the Hermansky-Pudlak syndrome mouse model, gunmetal. Specification Tested Reactivity: human Cited Reactivity: human, rat, pig, canine, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12136 Product name: Recombinant human RAB27A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-221 aa of BC107680 Sequence: MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC Predict reactive species Full Name: RAB27A, member RAS oncogene family Calculated Molecular Weight: 221 aa, 25 kDa Observed Molecular Weight: 25-27 kDa GenBank Accession Number: BC107680 Gene Symbol: RAB27A Gene ID (NCBI): 5873 RRID: AB_2176728 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51159 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.