Iright
BRAND / VENDOR: Proteintech

Proteintech, 17829-1-AP, SLC35E2B Polyclonal antibody

CATALOG NUMBER: 17829-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC35E2B (17829-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35E2B in WB, ELISA applications with reactivity to human, mouse samples 17829-1-AP targets SLC35E2B in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLC35E2B, also known as SLC35E2, encodes solute carrier family 35 member E2B, functioning as a putative transporter. SLC35E2B is expressed in the heart, retina, skin, testis, and kidney (PMID:33711669). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12211 Product name: Recombinant human RP11-345P4.4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-82 aa of BC092507 Sequence: MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITETTVIESDLGVWSSRALLYLTLW Predict reactive species Full Name: similar to solute carrier family 35, member E2 Calculated Molecular Weight: 236 aa, 43 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC092507 Gene Symbol: SLC35E2B Gene ID (NCBI): 728661 RRID: AB_3085542 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0CK96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924