Iright
BRAND / VENDOR: Proteintech

Proteintech, 17835-1-AP, IL-3 Polyclonal antibody

CATALOG NUMBER: 17835-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IL-3 (17835-1-AP) by Proteintech is a Polyclonal antibody targeting IL-3 in WB, IHC, ELISA applications with reactivity to human samples 17835-1-AP targets IL-3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein, Recombinant protein protein Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Interleukin-3 (IL-3) is a multilineage hematopoietic growth factor that promotes the proliferation, differentiation and survival of early multilineage hematopoietic progenitors. In particular, this cytokine plays a key role in stimulating the proliferation and survival of myeloid precursors. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders (PMID: 24103757;2698876;2809196) Specification Tested Reactivity: human Cited Reactivity: pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11839 Product name: Recombinant human IL-3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-152 aa of BC066273 Sequence: GLQAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF Predict reactive species Full Name: interleukin 3 (colony-stimulating factor, multiple) Calculated Molecular Weight: 152 aa, 17 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC066273 Gene Symbol: IL-3 Gene ID (NCBI): 3562 RRID: AB_10644127 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08700 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924