Iright
BRAND / VENDOR: Proteintech

Proteintech, 17836-1-AP, SPDYA Polyclonal antibody

CATALOG NUMBER: 17836-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SPDYA (17836-1-AP) by Proteintech is a Polyclonal antibody targeting SPDYA in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 17836-1-AP targets SPDYA in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Neuro-2a cells Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information SPDYA, also named as SPDY1, SPY1 and RINGO A, is a cell cycle regulator which regulates the G1/S phase transition of the cell cycle by binding and activating CDK1, CDK2 and CDKN1B/KIP. It has two isoforms with MW 33 kDa and 36 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12041 Product name: Recombinant human SPDYA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC093005 Sequence: MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLKKDKSMEWFTGSEE Predict reactive species Full Name: speedy homolog A (Xenopus laevis) Calculated Molecular Weight: 313 aa, 36 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC093005 Gene Symbol: SPDYA Gene ID (NCBI): 245711 RRID: AB_2878448 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5MJ70 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924