Product Description
Size: 20ul / 150ul
The CACNG7 (17862-1-AP) by Proteintech is a Polyclonal antibody targeting CACNG7 in IHC, ELISA applications with reactivity to human, mouse, rat samples
17862-1-AP targets CACNG7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag12334 Product name: Recombinant human CACNG7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 154-275 aa of BC093869 Sequence: SSINDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC Predict reactive species
Full Name: calcium channel, voltage-dependent, gamma subunit 7
Calculated Molecular Weight: 275 aa, 31 kDa
GenBank Accession Number: BC093869
Gene Symbol: CACNG7
Gene ID (NCBI): 59284
RRID: AB_2878456
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P62955
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924