Iright
BRAND / VENDOR: Proteintech

Proteintech, 17870-1-AP, STS Polyclonal antibody

CATALOG NUMBER: 17870-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The STS (17870-1-AP) by Proteintech is a Polyclonal antibody targeting STS in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17870-1-AP targets STS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF7 cells, human placenta tissue Positive IHC detected in: human placenta tissue, human hysteromyoma tissue, human kidney tissue, human lung tissue, human ovary tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information STS(Steroid sulfatase) is also named as ASC(arylsulfatase C), ARSC1 and belongs to the sulfatase family. It is expressed in human liver and is responsible for the hydrolysis of many estrogen and hydroxysteroid sulfates, including dehydroepiandrosterone (DHEA)-sulfate and β-estradiol(E2)-3-sulfate(PMID:19589875). This enzyme has also been documented to occur in many other tissues, including skin, lung, ovary, and adrenal gland. The estimated molecular mass of expressed human STS is 63-85 kDa which may represent different levels of glycosylation in the different tissues, as STS is known to be a glycoprotein and the full length protein has a signal peptide with 21 amino acids(PMID:17604157). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12353 Product name: Recombinant human STS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 236-583 aa of BC075030 Sequence: YFRPLNCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIYKGGKANNWEGGIRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNGCFATHVCFCFGSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQLCCPSTGLSCQCDREKQDKRLSR Predict reactive species Full Name: steroid sulfatase (microsomal), isozyme S Calculated Molecular Weight: 583 aa, 65 kDa Observed Molecular Weight: 63-65 kDa GenBank Accession Number: BC075030 Gene Symbol: STS Gene ID (NCBI): 412 RRID: AB_2240080 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08842 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924