Proteintech, 17881-1-AP, THOC7 Polyclonal antibody

Size: 20ul / 150ul The THOC7 (17881-1-AP) by Proteintech is a Polyclonal antibody targeting THOC7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17881-1-AP targets THOC7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human liver tissue, HEK-293 cells, mouse testis tissue, rat testis tissue Positive IHC detected in: human kidney tissue, human spleen tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information THOC7 is a member of the THO complex that associate with the mRNA export apparatus. It is required for efficient export of polyadenylated RNA. It acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11795 Product name: Recombinant human THOC7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC065012 Sequence: MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP Predict reactive species Full Name: THO complex 7 homolog (Drosophila) Calculated Molecular Weight: 204 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC065012 Gene Symbol: THOC7 Gene ID (NCBI): 80145 RRID: AB_10548743 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6I9Y2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.