Proteintech, 17897-1-AP, Opticin Polyclonal antibody

Size: 20ul / 150ul The Opticin (17897-1-AP) by Proteintech is a Polyclonal antibody targeting Opticin in WB, ELISA applications with reactivity to human, mouse, rat samples 17897-1-AP targets Opticin in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12257 Product name: Recombinant human OPTC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-332 aa of BC074943 Sequence: MRLLAFLSLLALVLQETGTASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGLLLSSQPNHGLPTCLVCVCLGSSVYCDDIDLEDIPPLPRRTAYLYARFNRISRIRAEDFKGLTKLKRIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQPAAFRAMEKLQFLYLSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT Predict reactive species Full Name: opticin Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC074943 Gene Symbol: Opticin Gene ID (NCBI): 26254 RRID: AB_2251719 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.