Proteintech, 17900-1-AP, LCN1 Polyclonal antibody

Size: 20ul / 150ul The LCN1 (17900-1-AP) by Proteintech is a Polyclonal antibody targeting LCN1 in WB, ELISA applications with reactivity to human samples 17900-1-AP targets LCN1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva tissue, Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12270 Product name: Recombinant human LCN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC074925 Sequence: MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD Predict reactive species Full Name: lipocalin 1 (tear prealbumin) Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 17-19 kDa GenBank Accession Number: BC074925 Gene Symbol: LCN1 Gene ID (NCBI): 3933 RRID: AB_2878462 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31025 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.