Proteintech, 17918-1-AP, SNX5 Polyclonal antibody

Size: 20ul / 150ul The SNX5 (17918-1-AP) by Proteintech is a Polyclonal antibody targeting SNX5 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 17918-1-AP targets SNX5 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, mouse kidney tissue, human kidney tissue, Neuro-2a cells, K-562 cells, Jurkat cells, U2OS cells Positive IP detected in: mouse kidney tissue Positive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX5 (Sorting nexin-5) was originally identified as a putative FANCA-binding protein (PMID: 10600472). SNX5 has a phox homology (PX) domain in the N-terminus. It is involved in several stages of intracellular trafficking. SNX5 is a component of the mammalian retromer complex, which is involved in recycling proteins from endosomes to the trans-Golgi network or plasma membrane (PMID: 17148574; 26199408). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12330 Product name: Recombinant human SNX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-404 aa of BC093623 Sequence: MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN Predict reactive species Full Name: sorting nexin 5 Calculated Molecular Weight: 404 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC093623 Gene Symbol: SNX5 Gene ID (NCBI): 27131 RRID: AB_2192708 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5X3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.