Proteintech, 17923-1-AP, DEFA6 Polyclonal antibody

Size: 20ul / 150ul The DEFA6 (17923-1-AP) by Proteintech is a Polyclonal antibody targeting DEFA6 in WB, IHC, ELISA applications with reactivity to human, mouse samples 17923-1-AP targets DEFA6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, mouse small intestine tissue Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. DEFA6 is alpha 6 of Defensin. This protein is secret expression and can be cleaved in to the fragments with MW 4-6 kDa. It can be used as a maker of Paneth cell. DEFA6 has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. it may protect cells against infection with HIV-1. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12341 Product name: Recombinant human DEFA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-100 aa of BC093951 Sequence: AEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL Predict reactive species Full Name: defensin, alpha 6, Paneth cell-specific Calculated Molecular Weight: 100 aa, 11 kDa Observed Molecular Weight: 6-10 kDa GenBank Accession Number: BC093951 Gene Symbol: DEFA6 Gene ID (NCBI): 1671 RRID: AB_2878468 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01524 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.