Iright
BRAND / VENDOR: Proteintech

Proteintech, 17926-1-AP, SFRS9 Polyclonal antibody

CATALOG NUMBER: 17926-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SFRS9 (17926-1-AP) by Proteintech is a Polyclonal antibody targeting SFRS9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17926-1-AP targets SFRS9 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells Positive IHC detected in: mouse kidney tissue, human cervical cancer tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SFRS9 is a member of the serine/arginine (SR) splicing factor family, which contains an N-terminal RNA recognition motif (RRM), a glycine-rich region, an internal region homologous to the RRM, and a long (315-amino-acid) C-terminal domain composed predominantly of alternating serine and arginine residues. SRSF9 has been linked to the occurrence and progression of hepatocellular carcinoma (HCC), colorectal cancer (CRC) and oral squamous cell carcinoma (OSCC). In HCC and CRC, the knockdown of SRSF9 inhibited the proliferation and migration of cancer cells, cell cycle progression and colony formation of cancer cells (PMID: 34336668,35971121). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12347 Product name: Recombinant human SFRS9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-221 aa of BC093973 Sequence: MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY Predict reactive species Full Name: splicing factor, arginine/serine-rich 9 Calculated Molecular Weight: 221 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC093973 Gene Symbol: SFRS9 Gene ID (NCBI): 8683 RRID: AB_2270087 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13242 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924