Proteintech, 17934-1-AP, DRD1 Polyclonal antibody

Size: 20ul / 150ul The DRD1 (17934-1-AP) by Proteintech is a Polyclonal antibody targeting DRD1 in WB, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 17934-1-AP targets DRD1 in WB, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IF-Fro detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Background Information Dopamine is a neurotransmitter that plays a crucial role in physical and mental health, such as cardiovascular, hormonal, renal, and central nervous systems (PMID: 29220802). Five subtypes of mammalian dopamine receptors are grouped into two classes, the D1- and D2-like classes. The D1-like class includes D1 and D5 receptors whereas the D2-like class includes D2, D3, D4 subtypes (PMID: 9457173). Dopamine receptor D1 (DRD1) is the most abundant form of dopamine receptor in the central nervous system. DRD1 stimulates adenylate cyclase, modulates D2 receptor activity, regulates neuron growth and differentiation, and mediates several behavioral responses (PMID: 1977312). DRD1 has a calculated molecular weight of 49 kDa, larger apparent molecular weight of 60-80 kDa may be due to glycosylation (PMID: 1281547; 23821371). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12366 Product name: Recombinant human DRD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 338-446 aa of BC074978 Sequence: RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT Predict reactive species Full Name: dopamine receptor D1 Calculated Molecular Weight: 446 aa, 49 kDa Observed Molecular Weight: 50-75 kDa GenBank Accession Number: BC074978 Gene Symbol: DRD1 Gene ID (NCBI): 1812 RRID: AB_10598308 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21728 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.