Proteintech, 17942-1-AP, Neurokinin-1 receptor Polyclonal antibody

Size: 20ul / 150ul The Neurokinin-1 receptor (17942-1-AP) by Proteintech is a Polyclonal antibody targeting Neurokinin-1 receptor in WB, ELISA applications with reactivity to human, mouse, rat samples 17942-1-AP targets Neurokinin-1 receptor in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, THP-1 cells, mouse pancreas tissue, Caco-2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information neurokinin 1 receptor (NK1R, also known as the tachykinin 1 receptor, TACR1), a mediator of behavioral stress responses, in alcohol dependence and treatment. One such neurotransmitter is substance P (SP), which together with its preferred TACR1 is highly expressed in brain areas involved in stress responses and drug reward, including the hypothalamus, amygdala, and nucleus accumbens (PMID: 18276852). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12368 Product name: Recombinant human TACR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 304-407 aa of BC074911 Sequence: IYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS Predict reactive species Full Name: tachykinin receptor 1 Calculated Molecular Weight: 407 aa, 46 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC074911 Gene Symbol: Neurokinin-1 receptor Gene ID (NCBI): 6869 RRID: AB_2200611 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25103 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.