Iright
BRAND / VENDOR: Proteintech

Proteintech, 17974-1-AP, BPHL Polyclonal antibody

CATALOG NUMBER: 17974-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BPHL (17974-1-AP) by Proteintech is a Polyclonal antibody targeting BPHL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17974-1-AP targets BPHL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human kidney tissue, human liver tissue, MCF-7 cells, mouse kidney tissue Positive IHC detected in: human kidney tissue, human heart tissue, human lung tissue, human ovary tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12085 Product name: Recombinant human BPHL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-194 aa of BC037778 Sequence: MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGWSLTLSPGWNAMA Predict reactive species Full Name: biphenyl hydrolase-like (serine hydrolase) Calculated Molecular Weight: 22 kDa, 32 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC037778 Gene Symbol: BPHL Gene ID (NCBI): 670 RRID: AB_2274994 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924