Proteintech, 17982-1-AP, UGT8 Polyclonal antibody

Size: 20ul / 150ul The UGT8 (17982-1-AP) by Proteintech is a Polyclonal antibody targeting UGT8 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 17982-1-AP targets UGT8 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue Positive IP detected in: rat brain tissue Positive IHC detected in: human brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information UGT8, also known as galacotosylceramide synthase or CGT (ceramide galactosyltransferase), is a key enzyme for galacotosylceramide (GalCer) biosynthesis. It is an ER transmembrane protein and has limited tissue distribution, with predominance in Schwann cells, oligodendrocytes, kidneys, testes, and intestine. UGT8 is highly enriched in myelin in the central nervous system. Its expression levels are strongly associated with histological typing in human oligodendrogliomas and astrocytomas; can be used as molecular marker to distinguish these tumors. Higher UGT8 levels had also been linked to metastatic properties of cancer cells. This antibody specifically recognizes the endogenous UGT8. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12393 Product name: Recombinant human UGT8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 38-402 aa of BC075069 Sequence: FKTLASALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNLLQRMKNTGVYLISRLGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVNGANEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGPKPKNLGNNTKLIEWLPQNDLLGHSKIKAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWK Predict reactive species Full Name: UDP glycosyltransferase 8 Calculated Molecular Weight: 541 aa, 61 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC075069 Gene Symbol: UGT8 Gene ID (NCBI): 7368 RRID: AB_2214254 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16880 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.