Iright
BRAND / VENDOR: Proteintech

Proteintech, 18004-1-AP, ST8SIA3 Polyclonal antibody

CATALOG NUMBER: 18004-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ST8SIA3 (18004-1-AP) by Proteintech is a Polyclonal antibody targeting ST8SIA3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 18004-1-AP targets ST8SIA3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, mouse liver tissue, Caco-2 cells Positive IHC detected in: human liver tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information The ST8 α-N-acetyl-neuraminide α-2,8-sialyltransferase (ST8Sia) family catalyzes the synthesis of one or multiple α2,8-linked sialic acid chains according to their acceptor specifificity (PMID:19888308). At least fifive ST8Sia enzymes (ST8SIA1, 2, 3, 4, and 6) have previously been identifified in adult brains (PMID:11530204). The ST8SIA3 is enriched in the striatum. The mouse St8sia3 gene shares 96% amino acid identity with human ST8SIA3, and is mainly expressed in the brain and testis (PMID:31455764). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12497 Product name: Recombinant human ST8SIA3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-380 aa of BC074909 Sequence: SLISYVSLKKENIFTTPKYASPGAPRMYMFHAGFRSQFALKFLDPSFVPITNSLTQELQEKPSKWKFNRTAFLHQRQEILQHVDVIKNFSLTKNSVRIGQLMHYDYSSHKYVFSISNNFRSLLPDVSPIMNKHYNICAVVGNSGILTGSQCGQEIDKSDFVFRCNFAPTEAFQRDVGRKTNLTTFNPSILEKYYNNLLTIQDRNNFFLSLKKLDGAILWIPAFFFHTSATVTRTLVDFFVEHRGQLKVQLAWPGNIMQHVNRYWKNKHLSPKRLSTGILMYTLASAICEEIHLYGFWPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA Predict reactive species Full Name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3 Calculated Molecular Weight: 380 aa, 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC074909 Gene Symbol: ST8SIA3 Gene ID (NCBI): 51046 RRID: AB_2239838 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43173 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924