Iright
BRAND / VENDOR: Proteintech

Proteintech, 18009-1-AP, Nucleoside phosphorylase Polyclonal antibody

CATALOG NUMBER: 18009-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Nucleoside phosphorylase (18009-1-AP) by Proteintech is a Polyclonal antibody targeting Nucleoside phosphorylase in WB, ELISA applications with reactivity to human, rat samples 18009-1-AP targets Nucleoside phosphorylase in WB, IF, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: Jurkat cells, U-937 cells, K-562 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Purine nucleoside phosphorylases (PNP) is a ubiquitous enzyme of purine metabolism that functions in the salvage pathway, including even those of protozoan parasites, thus enabling the cells to utilize purine bases recovered from metabolized purine ribo- and deoxyribonucleosides to synthesize purine nucleotides (PMID: 11337031, 23332162). PNP deficiency in humans leads to an impairment of T-cell function, usually with no apparent effects on B-cell function. hPNP is widely distributed in various tissues and cells of the human body, with the highest activity in kidney, peripheral lymphocytes and granulocytes (PMID: 38701712). Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12507 Product name: Recombinant human NP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC106074 Sequence: MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS Predict reactive species Full Name: nucleoside phosphorylase Calculated Molecular Weight: 289 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC106074 Gene Symbol: Purine nucleoside phosphorylase Gene ID (NCBI): 4860 RRID: AB_2034971 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00491 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924