Iright
BRAND / VENDOR: Proteintech

Proteintech, 18013-1-AP, IFN Alpha Polyclonal antibody

CATALOG NUMBER: 18013-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IFN Alpha (18013-1-AP) by Proteintech is a Polyclonal antibody targeting IFN Alpha in WB, ELISA applications with reactivity to human samples 18013-1-AP targets IFN Alpha in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information IFNA1 (IFN-alpha) is a member of the Type I IFN (1) family best known for their antiviral activity. It is a key cytokine regulating the activity of B cells, T-helper cells (Th cells), cDCs and natural killer cells (NK cells). IFN-alpha induces B cell maturation into plasma cells and immunoglobulin production. IFN-alpha plays an important role in the pathogenesis of systemic lupus erythematosus (SLE). IFN-alpha was the first cytokine to show clinical benefit in the treatment of certain types of cancer, including melanoma, chronic myelogenous leukemia, and renal cancer. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12533 Product name: Recombinant human IFNA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-189 aa of BC074928 Sequence: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE Predict reactive species Full Name: IFNA1 Calculated Molecular Weight: 189 aa, 22 kDa GenBank Accession Number: BC074928 Gene Symbol: IFN alpha1 Gene ID (NCBI): 3439 RRID: AB_2878481 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01562 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924