Iright
BRAND / VENDOR: Proteintech

Proteintech, 18027-1-AP, TRPM5 Polyclonal antibody

CATALOG NUMBER: 18027-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TRPM5 (18027-1-AP) by Proteintech is a Polyclonal antibody targeting TRPM5 in WB, IHC, IF, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 18027-1-AP targets TRPM5 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF detected in: mouse olfactory epithelium tissue Positive FC (Intra) detected in: LNCaP cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF): IF : 1:50-1:200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Transient receptor potential (TRP) proteins are a diverse family of proteins with structural features typical of ion channels (PMID: 14634208). TRPM5 is a member of the TRPM (melastatin-like) subfamily which are Ca(2+)-permeable cation channels localized predominantly to the plasma membrane (PMID: 11864597). TRPM5 plays a central role in taste transduction (PMID: 17610722). TRPM5 is implicated in enhancing TRPA1 expression and may be involved in regulating insulin secretion (PMID: 21932052). Alternative splicing results in transcript variants encoding distinct isoforms with calculated molecular weights of 98 kDa or 131 kDa. It has been reported that TRPM5 is N-linked glycosylated at a unique site and TRPM5 glycosylation seems not to be involved in channel trafficking, but mainly in its functional regulation (PMID: 24605085). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12593 Product name: Recombinant human TRPM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC093787 Sequence: MQDVQGPRPGSPGDAEDRRELGLHRGEVNFGGSGKKRGKFVRVPSGVAPSVLFDLLLAEWHLPAPNLVVSLVGEEQPFAMKSWLRDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAVRDHSLASTSTKVRVVAVGMASLGRVLHRRILEEAQEDFPVHYPEDDGGSQGPLCSLDSNLSHFILVEPGPPGKGDGLTELRLRLEKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDIVRWTKLLQNITSHQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLD Predict reactive species Full Name: transient receptor potential cation channel, subfamily M, member 5 Calculated Molecular Weight: 98 kDa, 131 kDa Observed Molecular Weight: 98 kDa GenBank Accession Number: BC093787 Gene Symbol: TRPM5 Gene ID (NCBI): 29850 RRID: AB_2287825 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZQ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924