Iright
BRAND / VENDOR: Proteintech

Proteintech, 18034-1-AP, GIP Polyclonal antibody

CATALOG NUMBER: 18034-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GIP (18034-1-AP) by Proteintech is a Polyclonal antibody targeting GIP in IHC, ELISA applications with reactivity to human, rat, mouse samples 18034-1-AP targets GIP in IHC, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive IHC detected in: human pancreas tissue, rat pancreas tissue, mouse pancreas tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GIP is an incretin hormone and belongs to the glucagon superfamily. GIP is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nutrient absorption.GIP stimulates insulin secretion via its G protein-coupled receptor activation of adenylyl cyclase and other signal transduction pathways. It is a relatively poor inhibitor of gastric acid secretion. Specification Tested Reactivity: human, rat, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12634 Product name: Recombinant human GIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-153 aa of BC069663 Sequence: EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR Predict reactive species Full Name: gastric inhibitory polypeptide Calculated Molecular Weight: 153 aa, 17 kDa GenBank Accession Number: BC069663 Gene Symbol: GIP Gene ID (NCBI): 2695 RRID: AB_2878484 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09681 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924