Proteintech, 18034-1-AP, GIP Polyclonal antibody

Size: 20ul / 150ul The GIP (18034-1-AP) by Proteintech is a Polyclonal antibody targeting GIP in IHC, ELISA applications with reactivity to human, rat, mouse samples 18034-1-AP targets GIP in IHC, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive IHC detected in: human pancreas tissue, rat pancreas tissue, mouse pancreas tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GIP is an incretin hormone and belongs to the glucagon superfamily. GIP is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nutrient absorption.GIP stimulates insulin secretion via its G protein-coupled receptor activation of adenylyl cyclase and other signal transduction pathways. It is a relatively poor inhibitor of gastric acid secretion. Specification Tested Reactivity: human, rat, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12634 Product name: Recombinant human GIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-153 aa of BC069663 Sequence: EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR Predict reactive species Full Name: gastric inhibitory polypeptide Calculated Molecular Weight: 153 aa, 17 kDa GenBank Accession Number: BC069663 Gene Symbol: GIP Gene ID (NCBI): 2695 RRID: AB_2878484 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09681 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.