Iright
BRAND / VENDOR: Proteintech

Proteintech, 18046-1-AP, PGLYRP1 Polyclonal antibody

CATALOG NUMBER: 18046-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PGLYRP1 (18046-1-AP) by Proteintech is a Polyclonal antibody targeting PGLYRP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 18046-1-AP targets PGLYRP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Peptidoglycan recognition protein 1 (PGLYRP1, also known as PGRP-S) belongs to a family of evolutionary conserved innate immunity proteins, which in mammals also include PGLYRP2, PGLYRP3, and PGLYRP4 (PMID: 17275309; 20418257). PGLYRP1 is highly expressed in polymorphonuclear leukocytes and to a lower extent in many non-immune cells (PMID: 20418257). It recognizes bacterial peptidoglycan and functions in antibacterial immunity and inflammation (PMID: 20418257). PGLYRP1 has been identified as a ligand for TREM-1 (PMID: 25595774). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12690 Product name: Recombinant human PGLYRP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-196 aa of BC101845 Sequence: MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP Predict reactive species Full Name: peptidoglycan recognition protein 1 Calculated Molecular Weight: 196 aa, 22 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC101845 Gene Symbol: PGLYRP1 Gene ID (NCBI): 8993 RRID: AB_3085550 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75594 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924