Iright
BRAND / VENDOR: Proteintech

Proteintech, 18064-1-AP, Histone H3.4 Polyclonal antibody

CATALOG NUMBER: 18064-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Histone H3 18064-1-AP targets Histone H3.4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse brain tissue, mouse testis tissue Positive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information HIST3H3, also known as H3.1t and H3.4, is a histone H3 protein variant that bears the H3.1 variant hallmark cysteine 96 but includes three extra amino acid substitutions. H3.1t was found to be expressed in primary human spermatocytes at the pachytene stage, similar to the human testis-specific histone H1t variant, where it appears therefore to take part in the process of spermatogenesis (PMID: 21782046). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12671 Product name: Recombinant human HIST3H3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC101837 Sequence: MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA Predict reactive species Full Name: histone cluster 3, H3 Calculated Molecular Weight: 136 aa, 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC101837 Gene Symbol: Histone H3.4 Gene ID (NCBI): 8290 RRID: AB_3669290 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16695 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924