Proteintech, 18096-1-AP, CENPP Polyclonal antibody

Size: 20ul / 150ul The CENPP (18096-1-AP) by Proteintech is a Polyclonal antibody targeting CENPP in WB, ELISA applications with reactivity to human samples 18096-1-AP targets CENPP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11865 Product name: Recombinant human CENPP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-288 aa of BC071726 Sequence: MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRLSGNCHMVTFQLEFQILEIQNKERLSSAVTDLNIIMEPTECSELSEFVSRAEERKDLFMFFRSLHFFVEWFEYRKRTFKHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENN Predict reactive species Full Name: centromere protein P Calculated Molecular Weight: 288 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC071726 Gene Symbol: CENPP Gene ID (NCBI): 401541 RRID: AB_2878498 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6IPU0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.