Proteintech, 18108-1-AP, CXCL17 Polyclonal antibody

Size: 20ul / 150ul The CXCL17 (18108-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL17 in IHC, ELISA applications with reactivity to human samples 18108-1-AP targets CXCL17 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon cancer tissue, human breast cancer tissue, human liver cancer tissue, human lung squamous cell carcinoma tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CXCL17, also known as C-X-C motif chemokine 17, is a relatively newly discovered member of the CXC chemokine family, which plays a multifaceted role in immune responses and other biological processes. CXCL17 has been implicated in several human pathologies, and its role in mediating immune responses is of particular interest. It is involved in the recruitment of immune cells, angiogenesis, and control of microorganisms at mucosal barriers . It is also known to be involved in tumor angiogenesis and has shown both proinflammatory and anti-inflammatory effects. CXCL17 is highly expressed in the gastric mucosa and other mucosal tissues. Its receptor was identified as GPR35 and named CXCR8, although the functional role of this interaction is not yet fully understood. CXCL17's expression is associated with both disease progression and protection in various diseases. It has been linked to pulmonary fibrosis, asthma, lung cancer, and hepatic cancer, where increased expression is associated with disease progression. Conversely, it may play a protective role in pancreatic cancer, autoimmune encephalomyelitis, and viral infections. Research has shown that CXCL17 promotes neutrophil trafficking and plays a role in the early proinflammatory response by facilitating the recruitment of neutrophils to the site of insult . It also exhibits chemoattractant abilities targeting monocytes and macrophages and can induce the production of proangiogenic factors such as vascular endothelial growth factor A from treated monocytes Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12516 Product name: Recombinant human CXCL17 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 23-119 aa of BC093946 Sequence: SLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL Predict reactive species Full Name: chemokine (C-X-C motif) ligand 17 Calculated Molecular Weight: 119 aa, 14 kDa GenBank Accession Number: BC093946 Gene Symbol: CXCL17 Gene ID (NCBI): 284340 RRID: AB_2878502 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXB2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.