Proteintech, 18113-1-AP, Uroguanylin Polyclonal antibody

Size: 20ul / 150ul The Uroguanylin (18113-1-AP) by Proteintech is a Polyclonal antibody targeting Uroguanylin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 18113-1-AP targets Uroguanylin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, mouse colon tissue, mouse small intestine tissue, rat pancreas tissue Positive IHC detected in: human pancreas cancer tissue, human kidney tissue, human stomach tissue, human colon cancer tissue, mouse small intestine tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Uroguanylin, also named as GUCA2B, is a candidate intestinal natriuretic hormone that controls the sodium and water balance between the intestine and the kidneys. It has been reported that the uroguanylin knockout mouse exhibits elevated blood pressure. Therefore, the GUCA2B gene is thought to be a susceptibility gene for essential hypertension (EH). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12589 Product name: Recombinant human Uroguanylin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-112 aa of BC093779 Sequence: TQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL Predict reactive species Full Name: guanylate cyclase activator 2B (uroguanylin) Calculated Molecular Weight: 112 aa, 12 kDa Observed Molecular Weight: 12-13 kDa GenBank Accession Number: BC093779 Gene Symbol: Uroguanylin Gene ID (NCBI): 2981 RRID: AB_10858615 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16661 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.