Iright
BRAND / VENDOR: Proteintech

Proteintech, 18115-1-AP, Synaptotagmin-13 Polyclonal antibody

CATALOG NUMBER: 18115-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Synaptotagmin-13 (18115-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptotagmin-13 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 18115-1-AP targets Synaptotagmin-13 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Synaptotagmin-13 is a member of the synaptotagmin family of proteins which are known as membrane trafficking proteins. Synaptotagmin-13 is composed of the canonical domains of synaptotagmins that include an N-terminal transmembrane region, two C-terminal cytoplasmic C2-domains, and a connecting sequence between the transmembrane region and the C2-domains (PMID: 11211934). Synaptotagmin-13 is highly expressed in brain and may be involved in transport vesicle docking to the plasma membrane. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12599 Product name: Recombinant human SYT13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-426 aa of BC093830 Sequence: CLCRHMHPKKGLLPRDQDPDLEKAKPSLLGSAQQFNVKKSTEPVQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDSRLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLPLAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSAKEPSAGAGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQARKLKKKQTKRAKHKINPVWNEMIMFELPDDLLQASSVELEVLGQDDSGQSCALGHCSLGLHTSGSERSHWEEMLKNPRRQIAMWHQLHL Predict reactive species Full Name: synaptotagmin XIII Calculated Molecular Weight: 426 aa, 47 kDa Observed Molecular Weight: 47 kDa, 66 kDa GenBank Accession Number: BC093830 Gene Symbol: Synaptotagmin-13 Gene ID (NCBI): 57586 RRID: AB_2199453 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L8C5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924