Iright
BRAND / VENDOR: Proteintech

Proteintech, 18126-1-AP, PARP15 Polyclonal antibody

CATALOG NUMBER: 18126-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PARP15 (18126-1-AP) by Proteintech is a Polyclonal antibody targeting PARP15 in WB, ELISA applications with reactivity to human samples 18126-1-AP targets PARP15 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, HepG2 cells, Jurkat cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12702 Product name: Recombinant human PARP15 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 96-444 aa of BC101701 Sequence: NRKSGVSRAILEGAGQAVESECAVLAAQPHRDFIITPGGCLKCKIIIHVPGGKDVRKTVTSVLEECEQRKYTSVSLPAIGTGNAGKNPITVADNIIDAIVDFSSQHSTPSLKTVKVVIFQPELLNIFYDSMKKRDLSASLNFQSTFSMTTCNLPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIEKIERIQNAFLWQSYQVKKRQMDIKNDHKNNERLLFHGTDADSVPYVNQHGFNRSCAGKNAVSYGKGTYFAVDASYSAKDTYSKPDSNGRKHMYVVRVLTGVFTKGRAGLVTPPPKNPHNPTDLFDSVTNNTRSPKLFVVFFDNQAYPEYLITFTA Predict reactive species Full Name: poly (ADP-ribose) polymerase family, member 15 Calculated Molecular Weight: 444aa,50 kDa; 656aa,73 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC101701 Gene Symbol: PARP15 Gene ID (NCBI): 165631 RRID: AB_2158519 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q460N3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924