Iright
BRAND / VENDOR: Proteintech

Proteintech, 18131-1-AP, Kindlin 3 Polyclonal antibody

CATALOG NUMBER: 18131-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Kindlin 3 (18131-1-AP) by Proteintech is a Polyclonal antibody targeting Kindlin 3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 18131-1-AP targets Kindlin 3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: J774A.1 cells, Jurkat cells, Raji cells, THP-1 cells, mouse kidney tissue, rat kidney tissue, K-562 cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Kindlin-3 (FERMT-3) is known to be central in hemostasis and thrombosis control and its deficiency disrupts platelet aggregation and causes Leukocyte Adhesion Deficiency disease. Point mutations in the kindlin-3 gene have been identified in humans with a rare inherited Integrin Activation efficiency Disease (IADD), also designated as Leukocyte Adhesion Deficiency syndrome (LAD-III or LADI variant). Kindlin-3 expression is restricted to cells of hematopoietic origin. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12713 Product name: Recombinant human FERMT3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 321-663 aa of BC004347 Sequence: DDLDVALSNLEVKLEGSAPTDVLDSLTTIPELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF Predict reactive species Full Name: fermitin family homolog 3 (Drosophila) Calculated Molecular Weight: 76 kDa Observed Molecular Weight: 72-76 kDa GenBank Accession Number: BC004347 Gene Symbol: Kindlin 3/FERMT3 Gene ID (NCBI): 83706 RRID: AB_2103056 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924