Iright
BRAND / VENDOR: Proteintech

Proteintech, 18167-1-AP, AMPK Alpha 2 Polyclonal antibody

CATALOG NUMBER: 18167-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AMPK Alpha 2 (18167-1-AP) by Proteintech is a Polyclonal antibody targeting AMPK Alpha 2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 18167-1-AP targets AMPK Alpha 2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, human skeletal muscle tissue, rat ovary tissue, SKOV-3 cells, MCF-7 cells Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: human breast cancer tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PRKAA2(protein kinase, AMP-activated, alpha 2 catalytic subunit), also named as AMPKA2, AMPK, PRKAA, AMPK2, belongs to the CAMK Ser/Thr protein kinase family and SNF1 subfamily. PRKAA2 is an αβγ heterotrimer that is activated by low cellular energy status, such as decreases in both the ATP/AMP ratio and the phosphocreatine content and it is a glycogen synthase kinase, phosphorylating Ser7 at the NH2 terminus, which decreases glycogen synthase activity (PMID:14532170). The protein can be ubiquitinated (PMID:21224036). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12796 Product name: Recombinant human PRKAA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 215-552 aa of BC069680 Sequence: DDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR Predict reactive species Full Name: protein kinase, AMP-activated, alpha 2 catalytic subunit Calculated Molecular Weight: 552 aa, 62 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC069680 Gene Symbol: AMPK Alpha 2 Gene ID (NCBI): 5563 RRID: AB_10695046 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P54646 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924