Proteintech, 18170-1-AP, Resistin Polyclonal antibody

Size: 20ul / 150ul The Resistin (18170-1-AP) by Proteintech is a Polyclonal antibody targeting Resistin in IHC, ELISA applications with reactivity to human samples 18170-1-AP targets Resistin in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Resistin is a member of the resistin-like molecule family (RELMs) that includes three additional proteins, RELM-α, RELM-β, RELM-y . Resistin is almost exclusively expressed in white adipocytes in mice, whereas macrophages are the primary source in humans . In a variety of pathophysiologic states, particularly in type 2 diabetes mellitus and in chronic kidney disease, the serum concentration of resistin is increased. (PMID: 32822824, PMID: 19708984) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12822 Product name: Recombinant human RETN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-108 aa of BC101560 Sequence: EAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP Predict reactive species Full Name: resistin Calculated Molecular Weight: 108 aa, 11 kDa GenBank Accession Number: BC101560 Gene Symbol: RETN Gene ID (NCBI): 56729 RRID: AB_2918058 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HD89 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.