Proteintech, 18171-1-AP, FGF5 Polyclonal antibody

Size: 20ul / 150ul The FGF5 (18171-1-AP) by Proteintech is a Polyclonal antibody targeting FGF5 in IHC, ELISA applications with reactivity to human, mouse samples 18171-1-AP targets FGF5 in IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human stomach tissue, human placenta tissue, human malignant melanoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, goat, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12824 Product name: Recombinant human FGF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-268 aa of BC074858 Sequence: LSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG Predict reactive species Full Name: fibroblast growth factor 5 Calculated Molecular Weight: 268 aa, 30 kDa GenBank Accession Number: BC074858 Gene Symbol: FGF5 Gene ID (NCBI): 2250 RRID: AB_2878511 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12034 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.