Iright
BRAND / VENDOR: Proteintech

Proteintech, 18175-1-AP, Frizzled 10 Polyclonal antibody

CATALOG NUMBER: 18175-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Frizzled 10 (18175-1-AP) by Proteintech is a Polyclonal antibody targeting Frizzled 10 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 18175-1-AP targets Frizzled 10 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information FZD10 (Frizzled homolog 10) is a member of the frizzled gene family, and considered as a seven-transmembrane Wnt-signaling receptor. FZD10 is expressed at high levels on the cell surface of almost all synovial sarcoma tissues but absent in most normal organs except for placenta. Up-regulation of FZD10 mRNA in several types of human cells might lead to carcinogenesis through activation of the beta-catenin-TCF signaling pathway with some class of WNTs. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken, zebrafish, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12867 Product name: Recombinant human FZD10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-229 aa of BC074998 Sequence: SMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVV Predict reactive species Full Name: frizzled homolog 10 (Drosophila) Calculated Molecular Weight: 581 aa, 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC074998 Gene Symbol: Frizzled 10 Gene ID (NCBI): 11211 RRID: AB_2108942 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULW2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924