Iright
BRAND / VENDOR: Proteintech

Proteintech, 18188-1-AP, HIST1H1T Polyclonal antibody

CATALOG NUMBER: 18188-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HIST1H1T (18188-1-AP) by Proteintech is a Polyclonal antibody targeting HIST1H1T in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 18188-1-AP targets HIST1H1T in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Testis-specific histone variants facilitate histone to protamine exchange during maturation of spermatozoa. Three testis-specific histone variants are regulated in male germ cells including H1T, H1T2 and HILS1 (encoded by H1ST1H1T, H1T2 and HILS1 respectively). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12908 Product name: Recombinant human HIST1H1T protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC069517 Sequence: MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMSLVALKKALAAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKSTRSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQKSPVKARASKSKLTQHHEVNVRKATSK Predict reactive species Full Name: histone cluster 1, H1t Calculated Molecular Weight: 206 aa, 22 kDa Observed Molecular Weight: 22-30 kDa GenBank Accession Number: BC069517 Gene Symbol: HIST1H1T Gene ID (NCBI): 3010 RRID: AB_2878515 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22492 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924