Proteintech, 18190-1-AP, MEOX1 Polyclonal antibody

Size: 20ul / 150ul The MEOX1 (18190-1-AP) by Proteintech is a Polyclonal antibody targeting MEOX1 in WB, ELISA applications with reactivity to mouse, rat samples 18190-1-AP targets MEOX1 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information MEOX1 (mesenchyme homeobox 1), also known as KFS2. It is expected to be located in nucleus and cytoplasm, and the protein is enriched in the adipose tissue, breast and heart muscle. The protein may play a role in the molecular signaling network regulating somite development. Mesodermal transcription factor that plays a key role in so mitogenesis and is specifically required for sclerotome development. Required for maintenance of the sclerotome polarity and formation of the cranio-cervical joints (PMID: 23290072, 24073994). The molecular weight of MEOX1 is 28 kDa, and it can recognize the band of 35 kDa (PMID:29678882). Specification Tested Reactivity: mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12910 Product name: Recombinant human MEOX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-254 aa of BC069474 Sequence: MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE Predict reactive species Full Name: mesenchyme homeobox 1 Calculated Molecular Weight: 254 aa, 28 kDa Observed Molecular Weight: 28-35 kDa GenBank Accession Number: BC069474 Gene Symbol: MEOX1 Gene ID (NCBI): 4222 RRID: AB_3085559 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50221 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.