Iright
BRAND / VENDOR: Proteintech

Proteintech, 18208-1-AP, DYSFIP1 Polyclonal antibody

CATALOG NUMBER: 18208-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DYSFIP1 (18208-1-AP) by Proteintech is a Polyclonal antibody targeting DYSFIP1 in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 18208-1-AP targets DYSFIP1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat skeletal muscle tissue Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DYSFIP1 is also known as PPP1R27. DYSFIP1 inhibits phosphatase activity of protein phosphatase 1 (PP1) complexes. The molecular weight of DYSFIP1 is 17 kDa. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12839 Product name: Recombinant human DYSFIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC093707 Sequence: MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD Predict reactive species Full Name: dysferlin interacting protein 1 Calculated Molecular Weight: 154 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC093707 Gene Symbol: DYSFIP1 Gene ID (NCBI): 116729 RRID: AB_3669295 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WC6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924