Iright
BRAND / VENDOR: Proteintech

Proteintech, 18237-1-AP, MMP28 Polyclonal antibody

CATALOG NUMBER: 18237-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MMP28 (18237-1-AP) by Proteintech is a Polyclonal antibody targeting MMP28 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 18237-1-AP targets MMP28 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, human colon tissue, mouse heart tissue Positive IHC detected in: human kidney tissue, human ovary tissue, human skin cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MMP28(Epilysin)can degrade casein and play a role in tissues homeostasis and repair .The only specific human cell type recognized to express epilysin is the basal keratinocyte in the skin, where epilysin expression is upregulated during wound repair(PMID:16940349).Western blot showed this antibody recognize bands at 62 and 58 kDa as well as breakdown products at 50, 48, and 46 kDa(PMID:15953044).This antibody is specific to MMP28. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12980 Product name: Recombinant human MMP28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-393 aa of BC002631 Sequence: LGNAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQSLYGKPLGGSVAVQLPGKLFTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKVQSV Predict reactive species Full Name: matrix metallopeptidase 28 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC002631 Gene Symbol: MMP28 Gene ID (NCBI): 79148 RRID: AB_2146444 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H239 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924