Iright
BRAND / VENDOR: Proteintech

Proteintech, 18248-1-AP, CLEC5A Polyclonal antibody

CATALOG NUMBER: 18248-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CLEC5A (18248-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC5A in WB, ELISA applications with reactivity to human, mouse samples 18248-1-AP targets CLEC5A in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: J774A.1 cells, K-562 cells, THP-1 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information C-type lectin domain family 5 member A (CLEC5A, also known as CLECSF5 and MDL1) is a spleen tyrosine kinase (Syk)-coupled receptor abundantly expressed by monocytes, macrophages and neutrophils (PMID: 10449773). It has a pivotal function in activating multiple aspects of innate immunity against bacterial invasion (PMID: 28824166). Both in vitro and in vivo evidence supported that CLEC5A was involved in glioblastoma pathogenesis via regulation of PI3K/Akt pathway (PMID: 30834619). It appeared as a protein band of ~36 kDa because of glycosylation, while its predicted molecular weight is 22 kDa (PMID: 25877931; 19074552). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13025 Product name: Recombinant human CLEC5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-188 aa of BC112099 Sequence: NKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK Predict reactive species Full Name: C-type lectin domain family 5, member A Calculated Molecular Weight: 188 aa, 22 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC112099 Gene Symbol: CLEC5A Gene ID (NCBI): 23601 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NY25 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924