Proteintech, 18268-1-AP, DEFA5 Polyclonal antibody

Size: 20ul / 150ul The DEFA5 (18268-1-AP) by Proteintech is a Polyclonal antibody targeting DEFA5 in IHC, ELISA applications with reactivity to human samples 18268-1-AP targets DEFA5 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:800-1:3200 Background Information DEFA5, also named as DEF5, belongs to the alpha-defensin family. It has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. Mature DEFA5 is about 5kd. It has a homodimer form. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12793 Product name: Recombinant human DEFA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-94 aa of BC069690 Sequence: ERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR Predict reactive species Full Name: defensin, alpha 5, Paneth cell-specific Calculated Molecular Weight: 94 aa, 10 kDa GenBank Accession Number: BC069690 Gene Symbol: DEFA5 Gene ID (NCBI): 1670 RRID: AB_2878526 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01523 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.