Iright
BRAND / VENDOR: Proteintech

Proteintech, 18333-1-AP, RAD18 Polyclonal antibody

CATALOG NUMBER: 18333-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RAD18 (18333-1-AP) by Proteintech is a Polyclonal antibody targeting RAD18 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 18333-1-AP targets RAD18 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293T cells, HeLa cells, K-562 cells, MCF-7 cells Positive IP detected in: K-562 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RAD18(E3 ubiquitin-protein ligase RAD18) is lalso named as RNF73, hHR18 and belongs to the RAD18 family. It is involved in postreplication repair of UV-damaged DNA. RAD18 protein is detected in human cells as two major bands at 75 and 85 kDa by Western blot. The bands are identified as nonubiquitinated and monoubiquitinated forms of Rad18, respectively(PMID: 15509568). Monoubiquitinated RAD18 is detected mainly in the cytoplasm, whereas nonubiquitinated RAD18 is detected predominantly in the nuclei(PMID:15509568). This antibody is specific to RAD18. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12944 Product name: Recombinant human RAD18 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-495 aa of BC001302 Sequence: MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN Predict reactive species Full Name: RAD18 homolog (S. cerevisiae) Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 75 kDa, 85 kDa GenBank Accession Number: BC001302 Gene Symbol: RAD18 Gene ID (NCBI): 56852 RRID: AB_2176586 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NS91 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924