Proteintech, 18370-1-AP, HCRTR1 Polyclonal antibody

Size: 20ul / 150ul The HCRTR1 (18370-1-AP) by Proteintech is a Polyclonal antibody targeting HCRTR1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 18370-1-AP targets HCRTR1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, SH-SY5Y cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The hypocretin receptor 1 (OX1R, also named HCRTR1) is a G protein-coupled receptor and is a critical participant in the regulation of motivated behavior (PMID:28971565). HCRTR1 is associated with the regulation of motivation, reward, and autonomic functions. HCRTR1 shows a selective binding affinity for HCRT1/orexin-A. Moreover, HCRTR1 and HCRTR2 share 64% sequence similarity in humans (PMID:34052813). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12269 Product name: Recombinant human HCRTR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 321-425 aa of BC074796 Sequence: KRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP Predict reactive species Full Name: hypocretin (orexin) receptor 1 Calculated Molecular Weight: 425 aa, 48 kDa Observed Molecular Weight: 48-54 kDa GenBank Accession Number: BC074796 Gene Symbol: HCRTR1 Gene ID (NCBI): 3061 RRID: AB_10858633 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43613 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.