Iright
BRAND / VENDOR: Proteintech

Proteintech, 18389-1-AP, CACNG1 Polyclonal antibody

CATALOG NUMBER: 18389-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CACNG1 (18389-1-AP) by Proteintech is a Polyclonal antibody targeting CACNG1 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 18389-1-AP targets CACNG1 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse skeletal muscle tissue, rat skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, SH-SY5Y cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12918 Product name: Recombinant human CACNG1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-184 aa of BC069493 Sequence: DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIILGSLCVLLSLGKKRDYLLRPASMFYAFAGLCILVSVEVMRQSVKRMIDSEDTVWIEYYYSWSFAC Predict reactive species Full Name: calcium channel, voltage-dependent, gamma subunit 1 Calculated Molecular Weight: 222 aa, 25 kDa GenBank Accession Number: BC069493 Gene Symbol: CACNG1 Gene ID (NCBI): 786 RRID: AB_2878540 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q06432 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924