Proteintech, 18423-1-AP, PSAP Polyclonal antibody

Size: 20ul / 150ul The PSAP (18423-1-AP) by Proteintech is a Polyclonal antibody targeting PSAP in WB, IHC, ELISA applications with reactivity to human samples 18423-1-AP targets PSAP in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, HepG2 cells Positive IHC detected in: human liver cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information proteins' (SAPs) that assist in the lysosomal hydrolysis of sphingolipids. After proteolytic processing of the presaposin protein, these 4 released polypeptides are functional activators. Saposin A was encoded by residues 60 to 143 of PSAP, saposin B by 195 to 275, saposin C by 311 to 390, and saposin D by 405 to 487. There are four 12-14 kDa heatstable glycoproteins. This antibody should recognize saposin D. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13266 Product name: Recombinant human PSAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 406-487 aa of BC001503 Sequence: GGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHK Predict reactive species Full Name: prosaposin Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC001503 Gene Symbol: PSAP Gene ID (NCBI): 5660 RRID: AB_10643525 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07602 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.