Iright
BRAND / VENDOR: Proteintech

Proteintech, 18424-1-AP, NOL7 Polyclonal antibody

CATALOG NUMBER: 18424-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NOL7 (18424-1-AP) by Proteintech is a Polyclonal antibody targeting NOL7 in WB, IF/ICC, ELISA applications with reactivity to human samples 18424-1-AP targets NOL7 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NOL7 (nucleolar protein 7) is localized in both the nucleolus and nucleoplasm, with its nucleolar localization being RNA-dependent. Its function in the nucleolus is likely related to maintaining nucleolar structure and cell growth, while its role in the nucleoplasm may be associated with anti-angiogenic effects. Additionally, NOL7 is involved in the accumulation of early pre-rRNA and the processing of pre-18S rRNA, which are crucial for maintaining nucleolar function and cell growth. The expression of NOL7 is regulated by various transcription factors, including c-myc and RXRα. In cervical cancer, NOL7 transcription is also positively regulated by the RB tumor suppressor gene. The NOL7 gene encodes three distinct splice variants, each with different intracellular localizations that may affect their functions. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13272 Product name: Recombinant human NOL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-257 aa of BC023517 Sequence: MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFKRRWMVRKMKTKK Predict reactive species Full Name: nucleolar protein 7, 27kDa Calculated Molecular Weight: 257 aa, 29 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC023517 Gene Symbol: NOL7 Gene ID (NCBI): 51406 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UMY1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924