Proteintech, 18590-1-AP, iASPP Polyclonal antibody

Size: 20ul / 150ul The iASPP (18590-1-AP) by Proteintech is a Polyclonal antibody targeting iASPP in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 18590-1-AP targets iASPP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, PC-3 cells, MCF-7 cells, Apoptosised HeLa cells, C6 cells Positive IP detected in: PC-3 cells Positive IHC detected in: human breast cancer tissue, human cervical squamous cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Inhibitor of apoptosis-stimulating protein of p53 (iASPP), encoded by PPP1R13L gene, is often overexpressed in human cancers. The ASPP family includes three members, namely ASPP1, ASPP2, and iASPP, which are specific regulators of p53-, p63-, and p73-mediated apoptosis. ASPP1 and ASPP2 enhance the apoptotic function of p53, whereas iASPP specifically inhibits p53-mediated apoptosis. Overexpression of iASPP is associated with resistance to cisplatin-induced apoptosis and rediation therapy. iASPP plays a pivotal role in regulating cancer cell proliferation and tumor progression. This antibody could both recognize unphosphorylated and phosphorylated iASPP. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13273 Product name: Recombinant human PPP1R13L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 481-829 aa of BC064913 Sequence: EGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPEQPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 13 like Calculated Molecular Weight: 89 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC064913 Gene Symbol: PPP1R13L Gene ID (NCBI): 10848 RRID: AB_2168573 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUF5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.