Proteintech, 18793-1-AP, Twinkle/PEO1 Polyclonal antibody

Size: 20ul / 150ul The Twinkle/PEO1 (18793-1-AP) by Proteintech is a Polyclonal antibody targeting Twinkle/PEO1 in WB, IHC, ELISA applications with reactivity to human samples 18793-1-AP targets Twinkle/PEO1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, MCF-7 cells, K-562 cells, HeLa cells Positive IHC detected in: human pancreas tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Twinkle, also named as Progressive external ophthalmoplegia 1 protein is a 684 amino acid protein, which involves in mitochondrial DNA (mtDNA) metabolism. The predicted full-length protein is 684 amino acids, with amolecular mass of 77 kD, whereas the splice variant mRNAencodes a 66-kD product of 582 amino acids, lacking residues 579-684 and terminating with four unique amino acids (PMID: 11431692). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6628 Product name: Recombinant human PEO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 154-506 aa of BC033762 Sequence: LVRPGDQQPRPLEALNGGFNLSRILRTALPAWHKSIVSFRQLREEVLGELSNVEQAAGLRWSRFPDLNRILKGHRKGELTVFTGPTGSGKTTFISEYALDLCSQGVNTLWGSFEISNVRLARVMLTQFAEGRLEDQLDKYDHWADRFEDLPLYFMTFHGQQSIRTVIDTMQHAVYVYDICHVIIDNLQFMMGHEQLSTDRIAAQDYIIGVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPDTSKRSK Predict reactive species Full Name: chromosome 10 open reading frame 2 Calculated Molecular Weight: 684 aa, 77 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC033762 Gene Symbol: PEO1 Gene ID (NCBI): 56652 RRID: AB_2066354 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RR1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.