Proteintech, 18853-1-AP, UBR2 Polyclonal antibody

Size: 20ul / 150ul The UBR2 (18853-1-AP) by Proteintech is a Polyclonal antibody targeting UBR2 in WB, ELISA applications with reactivity to human, mouse samples 18853-1-AP targets UBR2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: BxPC-3 cells, mouse cerebellum tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information UBR2(Ubiquitin-protein ligase E3-alpha-2) is also named as C6orf133, KIAA0349 and N-recognin-2. It is a component of the N-end rule pathway and recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. It has four isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13446 Product name: Recombinant human UBR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-347 aa of BC064512 Sequence: MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHELNTSEIEEEEDPLVHLSEDVIARTYNIFAITFRYAVEILTWEKESELPADLEMVEKSDTYYCMLFNDEVHTYEQVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYCEQAKSVIVRNTSRQTKPLKVQVMHSSIVAHQNFGLKLLSWLGSIIGYSDGLRRILCQVGLQEGPDGE Predict reactive species Full Name: ubiquitin protein ligase E3 component n-recognin 2 Calculated Molecular Weight: 439aa,50 kDa; 1755aa,201 kDa Observed Molecular Weight: 60-66 kDa GenBank Accession Number: BC064512 Gene Symbol: UBR2 Gene ID (NCBI): 23304 RRID: AB_10638437 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWV8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.