Proteintech, 18881-1-AP, MRPS17 Polyclonal antibody

Size: 20ul / 150ul The MRPS17 (18881-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS17 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 18881-1-AP targets MRPS17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13414 Product name: Recombinant human MRPS17 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-130 aa of BC054031 Sequence: MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ Predict reactive species Full Name: mitochondrial ribosomal protein S17 Calculated Molecular Weight: 130 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC054031 Gene Symbol: MRPS17 Gene ID (NCBI): 51373 RRID: AB_10597844 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2R5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.